SKU: 19890979744

LOX-1/OLR1 His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LOX-1/OLR1 His Tag Protein, MouseProduct Specification Species Mouse Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR E1 Accession Q9EQ09 Amino Acid Sequence Arg60 Ile363, with N terminal 9*His

Product Specification


Species Mouse
Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR-E1
Accession Q9EQ09
Amino Acid Sequence

Arg60-Ile363, with N-terminal 9*His HHHHHHHHHRQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

Expression System HEK293
Molecular Weight 45-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sawamura, T. et al. (1997) Nature 386:73. 

2.Daugherty, A. et al. (2000) Curr. Opin. Cardiovasc. Pulm. Ren. Invest. Drugs. 2:223. 

3.Platt, N. and S. Gordon (2001) J. Clin. Invest. 108:649. 3

4.Platt, N. and S. Gordon (1998) Chem. Biol. 5:R193.

Background

Lectin-like oxidized low-density-lipoprotein receptor-1 (LOX-1), also known as oxidized low-density-lipoprotein receptor-1 (OLR-1), is a type II transmembrane receptor belonging to the C-type lectin family. It also belongs to the functionally defined scavenger receptor (SR) superfamily, whose members share the common ability to bind and internalize modified forms of Low Density Lipoproteins (LDL). LOX-1 is the first member of the class E scavenger receptor subfamily (SR-E). It binds and supports the internalization of multiple structurally unrelated macromolecules including oxidized LDL, advanced glycation end products (AGE), activated platelets, bacteria, apoptotic or aged cells, and heat shock proteins. LOX-1 has also been implicated as an intestinal receptor involved in the transcytosis of pancreatic bile salt-dependent lipase. The human LOX-1 gene encodes a 273 amino acid (aa) residue protein with a short N-terminal intracellular domain, a transmembrane domain, an extracellular stalk/neck region followed by a C-type lectin-like domain (CTLD). The CTLD, which is required for ligand recognition, contains the six conserved cysteine residues present in all C-type lectins, but lacks the Ca2+-binding residues found in classical C-type lectins. LOX-1 can be detected on activated endothelial cells, vascular smooth muscle cells, macrophages, intestinal cells and dendritic cells. The expression of LOX-1 is induced by proinflammatory or proatherogenic stimuli, as well as by oxidized LDL itself and hemodynamic or oxidative stress. Human LOX-1 exists on the cell surface as covalent homodimers, which can further associate into non-covalent-linked oligomers. Cell surface LOX-1 can also be cleaved by yet unidentified proteases to release the soluble LOX-1 extracellular domain. Binding and endocytosis of oxidized LDL by LOX-1 induces oxidative stress, activates NF kappa B, and upregulates the expression of monocyte chemoattractant protein-1 and matrix metalloproteases. LOX-1-dependent oxidized LDL uptake also induces apoptosis by inducing the expression of the pro-apoptotic Bax and downregulation of the anti-apoptotic Bcl-2. Oxidized LDL plays a key role in the pathogenesis of atherosclerosis and endothelial dysfunction. Blockade of LOX-1 functions may turn out to be a suitable target for the therapeutic intervention of atherosclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19890979744

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Robert Moats
Cuba, US
★★★★★ 1
Don't waste your money.
Color: Silver
Don't waste your money and time on this piece of junk. The clasp on the band would not secure the watch to my wrist and you could not adjust the clasp. Watch kept falling off my wrist. I guess the price on the watch should indicate the cheapness.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 5, 2025
R
Robert Cox, NYC
Charlottesville, US
★★★★★ 5
Small digital watch
Color: Silver, Color: Silver
This is a nice looking, well made digital watch. It is easy to read and in most lighting conditions the numerals are dark and identifiable. It's a very small watch as you can see from the picture comparing it to a watch that I would wear normally. I think the bigger watch is 47 mm and this watch is 33 mm--quite a difference!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2024
B
Verified Purchase
BB's
Lake Worth, US
★★★★★ 5
Thin and tough
Nice and thin but tough. I can sit on this wallet and not have it bother me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
A
Verified Purchase
anonymous
New York, US
★★★★★ 5
Great, Long lasting for youtself or as a gift
Simple, it's Carhartt. I got it for my construction worker friend three years ago, and it's still in near-perfect condition today. plenty of space in it. A great gift, perfect for yourself - nothing else to say. You definitely get what you pay for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2026
D
Verified Purchase
Dexters lab assistant
San Leandro, US
★★★★★ 5
High-Quality, Long-Lasting Fabric Wallet - Exceptional Value
I recently purchased the Carhartt Men's Billfold and Passcase Wallet and have been nothing short of impressed with this product. Both its design and functionality have far surpassed my expectations, making it an indispensable accessory for daily use. The moment I unboxed the wallet, the quality was immediately apparent. The fabric is thick and sturdy - a clear hallmark of Carhartt, renowned for its durable gear. The stitching is clean and robust, with no loose threads, reinforcing the fact that this wallet is built to stand up to heavy use. The wallet’s design and layout are well thought out. With ample compartments for cash, cards, and identification, it allows for easy organization of your essentials. The separate passcase is an excellent feature that enhances the wallet's utility, offering quick access to your ID and frequently used cards. Despite the impressive storage capacity, the wallet maintains a slim profile, ensuring it fits comfortably in any pocket. Aesthetically, this wallet doesn't disappoint either. The fabric has a rich color, giving it a rugged yet sophisticated look that's suitable for both casual and formal settings. The embossed Carhartt logo is a symbol of quality and durability that aligns with the brand's reputation. What I truly appreciate is the wallet's longevity. Over time, it has proven its durability without any signs of wear and tear. The fabric has softened slightly for a more comfortable feel while maintaining its shape and strength. In conclusion, the Carhartt Men's Billfold and Passcase Wallet offers exceptional value. If you're in need of a new wallet, I cannot recommend this product highly enough. Its superior quality, robust design, and practical features make it a smart investment that, I believe, will endure daily use for years to come.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 6, 2023

recommand products