SKU: 24734907685

Human IL-12A, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 3 - Aug 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12A, His tagProduct Specification Species Human Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL 12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1 Accession P29459 Amino Acid Sequence Protein sequence (P29459, Arg23 Ser219, with C 10*His)

Product Specification


Species Human
Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1
Accession P29459
Amino Acid Sequence

Protein sequence (P29459, Arg23-Ser219, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 35-45 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-12 subunit alpha (IL-12 p35) is a protein that in humans is encoded by the IL12A gene. This gene encodes a subunit of the cytokine Interleukin 12 (IL-12) that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-dependent induction of interferon gamma (IFN-γ), and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24734907685

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
X
Verified Purchase
Xiaoli Zhang
New York, US
★★★★★ 5
Help training kitten poop
I have young kitten. It is attractive to me to use the Potty Training Tray. Kitten does not know to go to litter box initially. And they even eat cat litter. For safety, the trining tray is a good start to train their poop habit and also help a smooth transition to litter box when they get older.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 5
Great
Size: Medium, Number of Items: 1
I need something that was soft for my three year old and this ball is super great, it not only is the right size but it also fits in his mouth just right. Although he is a super aggressive chewer, the ball toy hasn't been totally destroyed yet and it is easy on his gums. The ball is so durable that got two of these toys just for fun.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
W
Verified Purchase
WMiracle
Massapequa, US
★★★★★ 5
The best!
UPDATE: 08/05/2025 - This is still one of my dog's 2 fav training/play toys. A couple of notes: 1. This is not a chew toy. If your pup is chewing up the rope, that's on you. That being said, you can get 100' of the poly cord rope at Home Depot for like $4.98. You can make nearly 100 ropes out of 100'. How hard is it to replace the rope????? 2. My pup is a now 15 month old Malinois. His original balls, purchase in September 2024 are still in everyday, multiple times per day, play. I did get careless and leave one where he got it and chew the rope. Easily replaced. Nothing to fret over. Yes, that was on me! 3.The foam ball is virtually indestructible! Replace the rope! 4. I noticed the price for the yellow large went from $12 each to $24. THIS will cause me to go elsewhere if they doubled in price. I LOVE these balls but not that much. I noticed they have a new yellow ball that has a strap vs. a rope. I might try that if I need one, but I have 6 of these balls, 2 never used yet, 2 that are virtually new looking, and 2 that have been in play since september 2024. I don't think I'll be buying more any time soon, but if I do need more, I hope they haven't gone up to $24 each. One of my top, go-to training tools. Quality is great other than the shrink wrap around the string joint. It's junk but not essential. Great tug and fetch toy. Essential to teaching a good "out" command (2 are recommended for this).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2025
R
Verified Purchase
Rosalie
Belleville, US
★★★★★ 5
Best dog ball
This is our go to dog toy for our German shepherd. its great for training in sports as well as outings at the beach, considering it floats! Never had him destroy one, so its extremely durable. I like that its a bright color so its easier to locate when i accidently let go of the rope too late and end up whipping it 20 ft into the woods. Easy to clean, all around just a great toy. Also love the large size as having a dog accidently lodge a ball into its throat is a real fear of mine, I do not have to worry about that with this toy. I should also mention the rope is a must, as touching a slobbery ball isn't the greatest feeling in the world and it puts your hands out of harms way. I will forever order these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 7, 2025
M
Verified Purchase
Mavis Adam
San Leandro, US
★★★★★ 4
Great ball, bad rope
Size: Medium, Number of Items: 1, Size: Medium, Number of Items: 1
My dog and I love the starmark ball on a rope tug toys. While this is one of the best tug toys we have found, I am continually disappointed with the quality of the rope. The plastic sleeve comes off the first day, and after that the stitching begins to weaken until the rope ends come apart and the rope slides out of the ball. Is there a way to improve this design so that this toy lasts longer? My dog is not left alone with the toy, it is only used as an interactive tug toy as a training reward. I am updating my review now several months later. I reinforced the rope with a paracord braid and the toy now lasts a very long time. My dog and I play with this toy everyday on our morning hike. He is a large German Shepherd with high ball drive. He carries this ball in his mouth several miles on our morning hike. We play fetch in the fields near our home and in the lake beyond the fields with this toy every day. This toy is his reward in obedience training and we play a lot of tug with it every day. Reinforcing the handle has made a huge difference as the toy lasts and lasts now with the improved rope. Great ball, we will always have a collection of them at our house!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 19, 2020

recommand products