SKU: 35158147686

Human BTLA/CD272, His tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 3 - Aug 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human BTLA/CD272, His tagProduct Specification Species Human Synonyms B and T lymphocyte associated protein Accession Q7Z6A9 Amino Acid Sequence Protein sequence(Q7Z6A9, Lys31 Arg157, with C 10*His) KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 4kDa Actual: 30kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance

Product Specification


Species Human
Synonyms B- and T-lymphocyte-associated protein
Accession Q7Z6A9
Amino Acid Sequence

Protein sequence(Q7Z6A9, Lys31-Arg157, with C-10*His) KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:16.4kDa Actual:30kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

B- and T-lymphocyte attenuator or BTLA (also known as cluster of differentiation 272 or CD272) is a protein that belongs to the CD28 immunoglobulin superfamily (IgSF) which is encoded by the BTLA gene. BTLA is broadly expressed in various organs. Among these are the lymph nodes, the thymus and the spleen where high expression of BTLA can be found. It is very similar in structure to PD-1 and CTLA-4. Therefore, it consists of an extracellular domain, a transmembrane domain and a cytoplasmic domain. The cytoplasmatic domain is indispensable for signalling and it is constituted of 3 important motives: the growth factor receptor-bound protein-2 (Grb-2) recognition motif, the immunoreceptor tyrosine-based inhibitory motif (ITIM) and the immunoreceptor tyrosine-based switch motif (ITSM). In many cases BTLA expression is connected with unfavourable outcomes as it, for instance, inhibits the function of human CD8+ cancer-specific T cells. However, some studies have shown that, for instance, colorectal carcinoma is associated with lower BTLA expression and that the lower BTLA expression is connected with poor survival. Hence, it seems that BTLA has rather a context-specific function. This fact should be taken into account if BTLA is to be used as a cancer therapy target.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35158147686

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Steve DeMola
Los Angeles, US
★★★★★ 5
Works great.
Color: Low profile oil Drain Pan for Motorcycles
Good size when changing the oil on a Harley Touring motorcycle.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
K
Verified Purchase
Kenneth J.
Massapequa, US
★★★★★ 5
Good product
Color: Low profile oil Drain Pan for Motorcycles
Love it! Built a custom box for my generator and this is under it so I can slide it in and out after so many oil changes 👍🏾👍🏾
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
R
Verified Purchase
Ramir Octavo
Fort Morgan, US
★★★★★ 5
oil tank
Color: Low Profile Oil Drain Pan for Harley
Slim and easy to use for any motorcycle or cars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
C
Verified Purchase
Claudia V.
Belleville, US
★★★★★ 5
1999 BMW 528i Fit and works like Original BMW-Pleasantly Surprised
1999 BMW 528i M52TU Engine. Pleasantly surprised and impressed. Everything fit as it should. Yes, one connector pipe took a bit more pressure to get it to "click" and lock, but it did click and lock..and better tight to insure no vacuum leak. Definitely works well and stopped the vacuum leak that old system had. Would recommend especially since price point might lead one to think that quality is not that good, but I'm glad I didn't spend any more on something else. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 3, 2025
T
Verified Purchase
Trarell D. Williams
Port Orchard, US
★★★★★ 5
Test fit to make sure it connects
When I revived it I thought it had looked a little too small until I compared it, I test fitted it and at first I thought it was a tad bit bigger but realized the more I pushed it in the more it went very tight fit and my car is running healthy. Installation is a pain but go to YouTube and search the “” the 50’s kid”” Who has two methods to getting them on, I went the intake removal route to replace additional parts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2020

recommand products