SKU: 52230077947

Human IL-6

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 31 - Aug 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6Product Specification Species Human Synonyms Interleukin 6, B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2), IL6, IFNB2 Accession P05231 Amino Acid Sequence Protein sequence (P05231, Val30 Met212)

Product Specification


Species Human
Synonyms Interleukin-6, B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IL6, IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence (P05231, Val30-Met212) VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Expression System HEK293
Molecular Weight

Predicted MW: 20.8 kDa Observed MW: 20, 21 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic. IL-6 stimulates the inflammatory and auto-immune processes in many diseases such as multiple sclerosis, neuromyelitis optica spectrum disorder (NMOSD), diabetes, atherosclerosis, depression, Alzheimer's disease, systemic lupus erythematosus, multiple myeloma, prostate cancer, Behçet's disease, rheumatoid arthritis, and intracerebral hemorrhage.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 52230077947

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Alex Lamberd
Natrona Heights, US
★★★★★ 5
One of the best Bat stories that I've read.
Format: Paperback
Coming off from The Long Halloween, Jeff Loeb and Tim Sale give us the sequel to their popular story tale in which we see Batman go at it with another year long mystery, while also giving us an origin story for the first Robin, Dick Grayson. After reading this book, I have come away having with even more love of the Dark Knight's mythology, while coming to see this as my favorite Batman story that I have read, even if it doesn't stand as well on its own. ON the narrative side of things, Loeb delivers a story fairly similar to the one he gave in The Long Halloween, though I feel this one is a bit more polished than Halloween was. Some have said that the retreading of plot structure have limited the way Loeb's later works are read, but I myself have no problem with it (for the most part), Loeb manages to do enough differently that you don't feel like you're reading the exact same story. The real big negative I'd have to give this graphic novel is that it really doesn't stand as well by itself than if you had read The Long Halloween. While I myself read that story before coming in to this one, I did see many connections that I would assume would through off any newcomers who hadn't read the prior story. But I will say that this is the story that had me invested the most emotionally. Without giving away any spoilers, that last page in the novel gave me such a cathartic experience that I really came to appreciate certain aspects of the Dark Knight's mythology, and how themes of loneliness were touched upon in a very genuine way. Looking at the art for the novel, Sale's work has improved much from The Long Halloween. I always mention in reviews concerning Sale that I was originally not a fan of his art, but after going through his work, you can't help but admire the level skill he manages to put in his drawings. There is a very big noir feeling in this novel (a plus for ) that is just delivered so well that any preferences in art I may have against Sale are put away in admiring the way he plays with lighting in the story. My biggest complaint for the art, which is a more of a personal thing really, is that I do not like the "pixie" costume they gave Robin (which is his default costume that many would associate him with). I have never really liked this costume, probably never will, but again, this is just me. Overall, I would say I really enjoyed the novel and would have to recommend it to any fans of the Batman (although I'd make sure you have read The Long Halloween first). This has come to be one of my most favorited Batman stories I've read, and I hope others will receive the same level of satisfaction that I have.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2014
L
Verified Purchase
Logan Fogg
Whiting, US
★★★★★ 5
MUST READ
Format: Kindle
Best Batman! This and the long Halloween are peak! Listening and reading the dc high vol on spotify is amazing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2025
H
Verified Purchase
Harrison Nowak
Massapequa, US
★★★★★ 4
Good sequel but not as good as the original.
Format: Paperback
Pretty good read only down side is it doesn’t quite live up to Long Halloween.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
K
Verified Purchase
Kurt
Battle Creek, US
★★★★★ 5
Great Sequel to Long Halloween
Format: Paperback
This takes all of the great elements of the Long Halloween and keeps it going. The two of those books together is a great story telling. Ticks all the boxes of a great Batman book. If you like this and Long Halloween check out The Penguin show on HBO Max. and if you like The Penguin but haven't read these two books you should since the show pulls a lot of influence from them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2024
K
Verified Purchase
kindlemom1 (My Guilty Obsession Blog)
San Leandro, US
★★★★★ 5
Worth the price!
Format: Paperback
Great set!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 8, 2025

recommand products