SKU: 53699894690

Human Doublecortin, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 31 - Aug 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Doublecortin, His tagProduct Specification Species Human Synonyms Doublin, Lissencephalin X (Lis X), DCX, DBCN, LISX Accession O43602 Amino Acid Sequence Protein sequence (O43602, Asn269 Ser360, with C 10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 11. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Doublin, Lissencephalin-X (Lis-X), DCX, DBCN, LISX
Accession O43602
Amino Acid Sequence

Protein sequence (O43602, Asn269-Ser360, with C-10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 11.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Doublecortin (DCX) is a microtubule-associated protein expressed by neuronal precursor cells and immature neurons in embryonic and adult cortical structures. In vivo and in vitro assays show that Doublecortin stabilizes microtubules and causes bundling. Doublecortin is a basic protein with an iso-electric point of 10 typical of microtubule-binding proteins. Doublecortin is mutated in X-linked lissencephaly and the double cortex syndrome, and the clinical manifestations are sex-linked. In males, X-linked lissencephaly produces a smooth brain due to lack of migration of immature neurons, which normally promote folding of the brain surface. Double cortex syndrome is characterized by abnormal migration of neural tissue during development which results in two bands of misplaced neurons within the subcortical white, generating two cortices, giving the name to the syndrome; this finding generally occurs in females. At least 49 disease-causing mutations in this gene have been discovered.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53699894690

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
kindleafterdark
Belleville, US
★★★★★ 5
A Beta’s Dream!
Format: Kindle
I loved this book!! Unwanted follows Cammie, a single mom and Beta, working two jobs, trying her best to raise a son and daughter since her a$$hole ex Alpha kicked them out after meeting his scent match. Being a Beta from the wrong side of the tracks, Cammie is often the victim of rumors and blatant disrespect from several alphas in town; and while in a panic searching for her daughter who somehow managed to wander outside of the home, she finds herself in a panic when she comes across a police officer. Rather than help her, Cammie finds herself feeling threatened and helpless against the alpha’s behavior. That’s when Reid, one of her Alpha neighbors (and super hot firefighter) swoops in to her rescue. Sparks fly, but Cammie thinks nothing of it since she is so used to being disregarded. Little does she know, Reid goes home to his Omega, the adorable and caring Finn, and confesses that he thinks he’s met their match. What follows is a beautiful hurt/comfort romance, with lots of steam, and found family perfection! Reid and Finn worship Cammie and absolutely adore her kids. They’ll do anything to protect them and cherish them, to erase all the hurt and rejection that their bio dad put them through. It’s such a heart warming and emotional story—perfect for when you’re feeling like something low angst with princess treatment for not just Cammie, but her kids as well. I definitely recommend picking this one up!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 28, 2024
L
Verified Purchase
Lisa Maddison
Lowell, US
★★★★★ 5
Emotional read with children
Format: Kindle
Cammie is a single mother of two children whose ex-boyfriend, who is an alpha that he met his scent matched omega and dumped her via messenger on his phone then the next day put their house up for sale. Cammie moves back to her hometown, but because she has no support, is working two jobs to keep her and the children in a small rented house. One night her four year gets out of the house and she meets a neighbour, but she refuses to make the same mistake again by getting involved with another alpha, but Reid is convinced they are scent matched mates even though Cammie is a beta. Reid and his omega Fin start to court Cammie and her two children that they belong together as a pack and family. Cammie's ten year old son is a tough one to convince, but the scenes between him and Reid and Fin, they were so good. I was tearing up at times, found family was a big theme and I really liked this book. I highly recommend that you try it too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2025
W
Verified Purchase
Whitney Moore
Dallas, US
★★★★★ 5
It’s an experience
Format: Paperback
⭐⭐⭐⭐⭐ **A Riveting and Emotionally Charged Journey** "Unwanted" by Sirena Song is an absolute masterpiece that grips you from the very first page and doesn't let go. The storytelling is impeccable, weaving together a tapestry of raw emotion, suspense, and heart-wrenching beauty. Song's ability to delve deep into the psyche of her characters makes them come alive, making you feel their pain, joy, and struggles as if they were your own. The plot is brilliantly crafted, full of unexpected twists and turns that keep you on the edge of your seat. Each chapter unfolds like a piece of a complex puzzle, gradually revealing the depth of the narrative. The themes of love, rejection, and redemption are explored with such nuance and sensitivity that it leaves a lasting impact. Sirena Song's prose is poetic and evocative, painting vivid pictures with her words and creating an immersive reading experience. The character development is outstanding, making it easy to become emotionally invested in their journeys. The ending is both satisfying and thought-provoking, leaving you pondering long after you've turned the last page. "Unwanted" is not just a book; it's an experience that touches the soul. I highly recommend it to anyone looking for a powerful and unforgettable read. Sirena Song has truly outdone herself with this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2024
T
Verified Purchase
TeamCieluch
Charlottesville, US
★★★★★ 4
Totally Sweet
Format: Kindle
🔥OmegaVerse 🔥Single Mom 🔥Scent Match 🔥Emotional Trauma Well written, emotional omegaverse about a single mom of 2 with an ex-Alpha boyfriend that found his Omega and ditched his family. Cammie has a meet cute with Reid and Finton separately but they both find her to be their scent match. This book is totally sweet with lots of drama but lots of proving to Cammie that she is loved and wanted. My Personal Ratings: 5 Stars: Loved it! Couldn’t put it down or obsessed about it while needing to get to the end of it. Had to share some bits with my hubby!! Usually read in less than 2 days cause a girl has got to sleep sometime. Will be reading everything this author has to offer and most likely reread the series as next books in the series are released. 4 Stars: Really Good. Whether the story drew me in or a specific character, will definitely continue the series and look into more books by this author. 3 Stars: Enjoyed something about the book, whether it be the storyline or a character but also may have not liked something. Sometimes the book is great but needs some TLC from an editor. May or may not continue the series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2024
R
Verified Purchase
Rae
Boise, US
★★★★★ 5
Read it!!! It's so good!
Format: Kindle
I will reccomend this book to anyone and everyone who is looking for an omegaverse book to read! The rabbit hole of male omega books this one sent my mood reading self down was crazy! 🤭 I could not have loved Finn more! He was the sweetest omega, making sure Cammie was comfortable each step of building a relationship with him and Reid. He was so good with the kids even though Ben was a little rough around the edges. Cammie's fears were all justified but the way she learned to trust her new pack was sweet! They just continued to show up and her sister was hilarious! Being a mom and thinking of her littles but also finding her own happiness was such a sweet journey for her 💖 lets just talk about the kids for a second and say Em is a spitfire and I LOVE her and Ben sweet Ben just wants to protect his Mama but needs love, Reid does such a good job stepping up! And the 'gift' at the end had me in tears!! 🥹 Without giving too much away that is why I think sweet Finn is my favorite of all male omegas I have ever read! His way with words no matter what he is using them for, declarations of love, pep talks, or advice he really just knows what needs to be said 💖
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2025

recommand products