SKU: 56290955557

CD7 Ligand/SECTM1 His Tag Protein, Mouse

Sale price$226.80 Regular price$252.00
Save 10%

Pay in installments of $63.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 31 - Aug 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 Ligand/SECTM1 His Tag Protein, MouseProduct Specification Species Mouse Antigen CD7 Ligand Synonyms CD7 Ligand, SECTM1, K12 Accession NP_663348 Amino Acid Sequence Gln28 Thr165, with C terminal 8*His QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGTGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Mouse
Antigen CD7 Ligand
Synonyms CD7 Ligand, SECTM1, K12
Accession NP_663348
Amino Acid Sequence

Gln28-Thr165, with C-terminal 8*His QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGTGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 25-35kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437.

2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi‑like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 56290955557

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
C. Coleman
Cuba, US
★★★★★ 5
Quality Case
Color: Pink
This is an All in Pne case. I really like the lavender color with sparkles. It is a little heavier than expected but I still love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
A
Verified Purchase
Amazon Customer
Omaha, US
★★★★★ 3
Ok, but don’t use hand cream
Color: Black, Color: Black
I like the case for its ability to house the keyboard, the pencil and the iPad in one convenient place. I find that the magnetic closure and magnets holding the keyboard are not as strong as a previous case I had purchased. The keyboard is great, I like the touchpad and the backlight colors. The cover material is not hand lotion friendly! I’ve tried water and lens cleaning wipes, and neither gets this cover clean. I hesitate to use any chemicals because the material is the type that will get sticky and nasty, and I don’t like that. I’ve included a photo of what the cover looks like after using a lens cleaning wipe. If the magnets were stronger and the cover material easier to clean, I would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
S
Verified Purchase
Seth Walton
Bozeman, US
★★★★★ 4
great case!
Color: Navy Blue
pros; the color is beautiful. I picked the navy blue. It is exactly as the description described. It goes very well with my blue iPad. The size is very precise and fits perfectly on my iPad. The magnet that holds the case together is very strong. The iPad itself can pivot vertically and horizontally using that magnet. This works very smooth. The magnet closure for the case itself is strong and holds well. The magnet that holds the keyboard in place also works very well. Cons; when the keyboard is in its correct position, it is difficult to angle the iPad in front into the provided grooves. The keyboard gets into the way. This prevents the iPad from reaching the grooves provided. The keyboard feels very light and cheap. The keyboard itself connected with the Bluetooth very easily. It works wonderful. I love the back light on the keyboard. The color of the keyboard is wonderful. However, as I said above, it does feel a bit cheap. But for 20 bucks, what can you ask for. When the case is folded together with the keyboard in the iPad, it is a bit bulky. But I knew that from the previous reviews and was expecting it. What I love most about this case is that the iPad can be removed using the magnet on the back from the keyboard portion, but it is still protected by the exterior plastic case. So in situations where I don’t need to use my keyboard, I can remove the iPad itself and know that it’s still protected overall I recommend this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 5
Nice Case & Keyboard
Color: Blue
Love this case with a keyboard. I like using the keyboard vs using one on the screen of iPad. And the keyboard has rechargeable batteries instead of having to buy batteries. And it protects my iPad.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
E
Verified Purchase
Eli Beltran
Lake Worth, US
★★★★★ 1
Beautiful, and everything I want it except that the keyboard keys didn’t work😭
Color: Light Pink
I searched and search for the right keyboard case for me. The most important thing for me was to be able to remove the iPad case itself from the whole case and keyboard, and this one was it. Unfortunately, when I started checking the keyboard a lot of The keys were not output in the correct symbol or letters. So defeats the whole purpose of having a keyboard. I returned it and asked for a replacement, thinking that the item was defected, but when I got the New replacement, it was the same thing so I tried to contact the seller, but there was no option to do that. Therefore, I had to return the second replacement keyboard and look for another keyboard cover.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026

recommand products