SKU: 68090964206

Mouse IFN-alpha1 Protein, His Tag

Sale price$31.50 Regular price$35.00
Save 10%

Pay in installments of $8.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IFN-alpha1 Protein, His TagProduct Specification Species Mouse Synonyms Interferon alpha 1, IFN alpha 1, Ifna1 Accession P01572 Amino Acid Sequence Protein sequence (P01572, Cys24 Lys189, with C His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed MW: 20 kDa Purity 95% by SDS PAGE

Product Specification


Species Mouse
Synonyms Interferon alpha-1, IFN-alpha-1, Ifna1
Accession P01572
Amino Acid Sequence

Protein sequence (P01572, Cys24-Lys189, with C-His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interferon alpha-1 is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68090964206

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jen
Lexington, US
★★★★★ 5
Comfortable yoga mat
Color: Blue Mist, Style: 1/2 inch, Color: Blue Mist, Style: 1/2 inch
I was due for a new yoga mat as I practice every day anywhere from 10 minutes to 45 minutes. Over the years I've taken to liking the 1/2" thick mats with the grip lines. They're just easier on the joints (two acl reconstructions and a spinal fusion from T2 to L2) and a plate in my wrist. This mat is great. I like the design and color, the thickness is perfect, no smell AT ALL which is both rare and awesome. I used it today and found it comfortable. I also like the 72" length because I'm about 5'9 so I'm not hanging off the mat. I've been practicing yoga for over 15 years and have my CYT 200 even though I don't teach, and I would highly recommend this mat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
S
Verified Purchase
Sara
Natrona Heights, US
★★★★★ 5
Thick/Fluffy
Color: Violet Haze, Style: 1/2 inch
I’ve really been enjoying this yoga mat. It’s fluffy and thick, which gives great support for my knees during certain poses and stretches. The length is also perfect, especially for someone on the taller side. I chose the light purple color, and it matches the pictures perfectly. As someone who practices yoga regularly and also uses it for stretching in my home gym, I think this mat is a great choice for both comfort and support.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
J
Verified Purchase
Julia
Battle Creek, US
★★★★★ 5
Great for hand pain while working out.
Color: Wild Spruce, Style: 1/2 inch
Not squeaky, non slip. Much thicker and comfier than a normal yoga mat. Only thing is wearing sneakers on it, it might give you some more squeak. Just wipe down with a wet wipe after class. Keep it in my car. Purple color is perfect- muted yet a statement. Goes with all my clothes/towels.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
M
Verified Purchase
Mariia Vetchynova
Carnegie, US
★★★★★ 4
Lightweight yoga mat
Color: Rose, Style: 1/2 inch
The yoga mat is not one of those heavy-duty ones. It’s quite light, but it tends to crease easily and takes a long time to return to its original shape after being rolled or folded.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
C
Verified Purchase
Chica Chica Chickpea
Omaha, US
★★★★★ 5
Great Mat!
Color: Boysenberry, Style: 1/2 inch
I’ve been using this mat 4+ days a week for 2.5 months and it is durable and comfortable. I use it for yoga, sculpt, and Pilates. It’s held up during burpees, pushups, and plenty other moves that I half expected would tear the mat, but it’s held up great. It also gets wiped down with a disinfectant after each use. Still like new. Great price too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026

recommand products