SKU: 87119004019

Human L-selectin, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human L-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member L, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte surface antigen Leu 8, Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90 MEL, SELL, LNHR, LYAM1 Accession P14151 Amino Acid Sequence Protein sequence (P14151, Trp39 Val194, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1
Accession P14151
Amino Acid Sequence

Protein sequence (P14151, Trp39-Val194, with C-10*His) WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.9 kDa Observed MW: 24, 26-33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin belongs to the selectin family of proteins, which recognize sialylated carbohydrate groups containing a Sialyl LewisX (sLeX) determinant. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation. It is cleaved by ADAM17. L-selectin expressed on CD4 T lymphocytes has been implicated in mediating adhesion and entry of HIV. Deficiency epithelial expression of L-selectin ligands has been associated with infertility, while increased expression has been implicated in ectopic pregnancies. The adhesive properties of L-selectin have been shown to contribute to cancer progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87119004019

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lilly Angell
Chelsea, US
★★★★★ 5
Love!
Color: Embossed Leather - Tan
Surprisingly good quality. My boyfriend loves that you can take out the smaller bifold piece and use it on its own if needed - a 2 in 1.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026
D
Verified Purchase
DJ
Boise, US
★★★★★ 5
Great quality, Highly Impressed!
Size: 12, Color: Light Brown
These are of great quality and surprisingly comfortable. This is my first pair of HEYDUDE. I am really impressed! They are true to size. They fit my wide feet without any issues and they are my new absolute favorites! Super lightweight, extra stylish with the platform lift, and completely worth it. The color matches the photos.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
T
Verified Purchase
Thryn.R.
Whiting, US
★★★★★ 5
Slip on shoe love
Size: 9, Color: Black/Black, Size: 9, Color: Black/Black
These are a more narrow fit so if you are a wide fit girlie or you don’t like tight fitting shoes you might want to try to size up or try to find something that has a wide version. But I love them super cute and absolutely great quality..skip on and slip off love it!!! I will be looking into a different color,I got black for work ..but they are comfortable . Update-after wearing the black suede for a few days I purchased the brown suede as well.... And I can say they do loosen up a little still a a narrow fit but not right feeling.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
M
Verified Purchase
marina p.
Dallas, US
★★★★★ 5
Walking on clouds…
Size: 6, Color: Blush, Size: 6, Color: Blush
The most comfortable shoes I have ever had. Usually I wear size 6,5 -7. I followed recommendations and order size 6. It was a perfect fit. It was ideal for my problematic wide feet. The shoes are light weight and well made. They look great and feel as cozy as slippers. Absolutely love them and strongly recommend to go size down as I did.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
J
Verified Purchase
jb
Pawtucket, US
★★★★★ 5
Comfort and fashion collide
Size: 7, Color: Brown Leopard
These platform mules meet the following three criteria points: fashionable, comfortable, and affordable. I wear them all day thanks to the great arch support. In fact, I have three pairs in multiple colors. I normally wear a 7.5 but sized down to 7 after trying a 7 and 8.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026

recommand products